PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010542805.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 714aa    MW: 78230.5 Da    PI: 6.6798
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010542805.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT++E+ ++++a +++G   W +I +++g ++t+ q++s+ qk+
   XP_010542805.1 24 RERWTEDEHSRFLEALRLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.24E-151872IPR009057Homeodomain-like
PROSITE profilePS5129418.3231973IPR017930Myb domain
TIGRFAMsTIGR015574.8E-172272IPR006447Myb domain, plants
SMARTSM007171.0E-112371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-72464IPR009057Homeodomain-like
PfamPF002491.7E-122467IPR001005SANT/Myb domain
CDDcd001671.44E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MEKNISGEEL VTKIRKPYTI TKQRERWTED EHSRFLEALR LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KQPYAWKAST WMRFAVDASI ELHKKLLEKE AQAKGIPICQ ALDIEIPPPR  120
PKRKPSNPYP RKTGNGESTS QVSSAKVVKL DSSASFSHCN QALDLEKKPF TEKPNGVEKV  180
PNGNGNQDDN CSGVSARPTE AHCSSISSVN KYPFPNKAAP RNPSSFRESE PDLTKATADN  240
GTSKTSNADN SCYSQDNDAN VLPHISISKE DNGVNGLSPV GNMNGIQSYP WHFPVHVLNG  300
NVGTYPQNPP DNVPRSSRQA FPAFHPAFVP ACHTQDDYRS FLQISSTFSN LIMSALLQNP  360
AAHAAATFAA SFWPYGNVGS SNDSSTSTTI QTDGAFPPRQ MSSPPPSMAA ITAATVAAAT  420
AWWAAHGLLP ICAPFTCLPM SAPIVPPSVS AQTELPETDK KDAATANPQQ PAMEQGEAQV  480
LASPFESDDD LDENGRTEQD TGLKTEDHKE KVVEVQEQVQ DSNTTQKKKQ VDRSSCGSNT  540
PSGSDVETDA LEKAAEKDKE EDVKETDGNQ TGTESSTRRT SRSKDNSSDS WKEVSEEGRM  600
AFDALFARER LPQSFSLALD VEKESPEKGK GNREEREREM AHKSKIQDSC SKETASRSEG  660
NGGITIGIGE GKSLRARRTG FKPYKRCSME AKESSSQAEE KVSKRIRLDS KAST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010542805.10.0PREDICTED: protein LHY-like isoform X4
SwissprotQ6R0H11e-180LHY_ARATH; Protein LHY
TrEMBLE4MW670.0E4MW67_EUTHA; mRNA, clone: RTFL01-03-N03
TrEMBLV4L3680.0V4L368_EUTSA; Uncharacterized protein
STRINGAT1G01060.11e-178(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-135MYB_related family protein